PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00004g01918.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 150aa    MW: 17229.4 Da    PI: 10.2628
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00004g01918.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.9e-1181125347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT  E++ ++ + k+lG+g+W+ I+++    Rt  q+ s+ qky
  Peaxi162Scf00004g01918.1  81 PWTDKEHKHFLIGLKELGKGDWRGISKEYVPSRTSIQVASHAQKY 125
                               8**************************9999*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.631722IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129413.08674130IPR017930Myb domain
SuperFamilySSF466892.01E-1577129IPR009057Homeodomain-like
SMARTSM007171.7E-578128IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.0E-1579128IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-979127IPR009057Homeodomain-like
CDDcd001671.91E-681126No hitNo description
PfamPF002491.8E-881125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MTKKDARKCS HCGHSGHNSR TCNNNVKEVK LFGVRIDDNN HQGGDSKMKM KVEDELIRSK  60
SLGNMENDVN DLHNNVDTRI PWTDKEHKHF LIGLKELGKG DWRGISKEYV PSRTSIQVAS  120
HAQKYFNRIA TPTNRKKRRS SVFDVQLNDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778274.13e-56PREDICTED: transcription factor MYB1R1-like
RefseqXP_016481927.13e-56PREDICTED: transcription factor MYB1R1-like
TrEMBLM1BY827e-52M1BY82_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000556162e-51(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.19e-39MYB_related family protein